PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn032371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 325aa    MW: 37133.2 Da    PI: 8.9306
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn032371genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-3162115255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH rFv+ave+LGG+e+AtPk +l+lm++kgL ++hvkSHLQ+YR 
  Achn032371  62 PRLRWTPDLHLRFVHAVERLGGQERATPKLVLQLMNMKGLNISHVKSHLQMYRR 115
                 8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.70158118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2958115IPR009057Homeodomain-like
SuperFamilySSF466896.81E-1460114IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-2262116IPR006447Myb domain, plants
PfamPF002491.1E-863114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEGNDSSECS KTSPRLDQNE EEEEEETNNT GKARDSASSS NSTVEESERK SSVRPYVRSK  60
MPRLRWTPDL HLRFVHAVER LGGQERATPK LVLQLMNMKG LNISHVKSHL QMYRREKIDD  120
PSQALADHRH LVEVGDRNVY NLSQLPMLQG FNRRHHSSFR FGNTSWSGHE NWVHSPFISR  180
SRIDTERSGF YGTFHERVFG NRYSNLANEQ STWRNNEPKE AFGSIHDPLI NAQLQVKELG  240
NLSNHIPHDL NKRMNIEERI AVKRKASNWD LDLNLSLGVK QKIEEDNSNL SLSLYLGSSK  300
ISGSKEGDSE KNGRRKASTL DLTI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002268055.11e-108PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA5AMV61e-108A5AMV6_VITVI; Putative uncharacterized protein
STRINGPOPTR_0016s12940.17e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-57G2-like family protein